PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009625487.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 398aa    MW: 44448.9 Da    PI: 4.9803
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009625487.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.31e-51281551128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     l+pGfrFhPtdeelv +yL++k+ gk++++ ++++e+d+yk+ePw+L +  ++k+++ ewyfFs+ dkky +g+r nrat +gyWkatgkd+ v 
  XP_009625487.1  28 LAPGFRFHPTDEELVRYYLRRKACGKPFRF-QAVTEIDVYKSEPWELAEysSLKSRDLEWYFFSPVDKKYGNGSRLNRATGQGYWKATGKDRFVR 121
                     579*************************99.88**************84346777888************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + k++++g+kktLvf++grap+g++t+Wvmheyrl
  XP_009625487.1 122 H-KSQTIGMKKTLVFHSGRAPDGQRTNWVMHEYRL 155
                     9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-6224178IPR003441NAC domain
PROSITE profilePS5100557.8228178IPR003441NAC domain
PfamPF023653.8E-2830155IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MEQEGSLVVA AAAGAVTVAA PAPAPTSLAP GFRFHPTDEE LVRYYLRRKA CGKPFRFQAV  60
TEIDVYKSEP WELAEYSSLK SRDLEWYFFS PVDKKYGNGS RLNRATGQGY WKATGKDRFV  120
RHKSQTIGMK KTLVFHSGRA PDGQRTNWVM HEYRLADEEL EKAGIVQDSF VLCRIFQKSG  180
LGPPNGDRYA PFVEEEWDDD IAVIPGGEAE DDVANGDEAR VAGNDLDQDA LRKAPRYIEN  240
LIEPQSLPFV CKRESSEDAE LLSLSQSKRS KHDDPSSSRA NGSEDSTITS QDLPTTMMTK  300
TNCSPTLLGF PLLESLETKE GQPSNPPTFD SSNLEKSVPP GYLKFISNLE NGILNVSMER  360
ETLKIEVMRA QAMINLLQSR VDLLTKENEG MRRIVREG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-522717819168NAC domain-containing protein 19
3swm_B3e-522717819168NAC domain-containing protein 19
3swm_C3e-522717819168NAC domain-containing protein 19
3swm_D3e-522717819168NAC domain-containing protein 19
3swp_A3e-522717819168NAC domain-containing protein 19
3swp_B3e-522717819168NAC domain-containing protein 19
3swp_C3e-522717819168NAC domain-containing protein 19
3swp_D3e-522717819168NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF5098710.0AF509871.1 Petunia x hybrida nam-like protein 8 (NH8) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009625487.10.0PREDICTED: NAC domain-containing protein 78-like
SwissprotQ84K002e-93NAC78_ARATH; NAC domain-containing protein 78
TrEMBLQ8LRL70.0Q8LRL7_PETHY; Nam-like protein 8
STRINGPGSC0003DMT4000797910.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31402448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10490.22e-92NAC domain containing protein 52